SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15993

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SARS-CoV-2 nsp16 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP16 (YP_009725302.1). RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp16 AntibodyAzide and BSA Free [NBP3-15993]

Western Blot: SARS-CoV-2 nsp16 AntibodyAzide and BSA Free [NBP3-15993]

Western Blot: SARS-CoV-2 nsp16 Antibody [NBP3-15993] - Western blot analysis of extracts of normal 293T cells and 293T transfected with NSP16 Protein, using SARS-CoV-2 nsp16 antibody (NBP3-15993) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:2000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 nsp16

Alternate Names

Non-structural protein 16, nsp16, ORF1a polyprotein, ORF1ab polyprotein, pp1a, Replicase polyprotein 1a

Gene Symbol

ORF1ab

Additional SARS-CoV-2 nsp16 Products

Product Documents for SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SARS-CoV-2 nsp16 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SARS-CoV-2 nsp16 Antibody - Azide and BSA Free and earn rewards!

Have you used SARS-CoV-2 nsp16 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies