SARS-CoV-2 nsp4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-15991

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SARS-CoV-2 nsp4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of coronavirus NSP4 (YP_009725300.1). RRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

794 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SARS-CoV-2 nsp4 Antibody - BSA Free

SARS-CoV-2 nsp4 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp4 Antibody - Azide and BSA Free [SARS-CoV-2 nsp4] -

Western Blot: SARS-CoV-2 nsp4 Antibody - Azide and BSA Free [SARS-CoV-2 nsp4] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with SARS-CoV-2 nsp4 using SARS-CoV-2 nsp4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 20 ug/10 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for SARS-CoV-2 nsp4 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunoprecipitation

0.5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 nsp4

SARS-CoV-2 Nonstructural Protein 4 (NSP4) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP4 is 500 amino acids (aa) with a theoretical molecular weight of 56.2 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP4 has 80% sequence identity and 95% sequence similarity (1). Structurally, SARS-CoV-2 NSP4 protein has four transmembrane domains (3). SARS-CoV-2 interactome studies revealed that NSP4 interacts with the TIM (translocase of the inner membrane) complex, indicating an association with the mitochondria (2). Additionally, SARS-CoV-2 NSP4 is shown to interact with NSP3 and this interaction is required for viral replication (1). Specifically, the NSP3-NSP4 interaction is responsible for double membrane vesicle formation (3).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M.,... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39

Alternate Names

Corona_NSP4_C, Coronavirus nonstructural protein 4 C-terminus, Non-structural protein 4, nsp4

Gene Symbol

ORF1ab

Additional SARS-CoV-2 nsp4 Products

Product Documents for SARS-CoV-2 nsp4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SARS-CoV-2 nsp4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SARS-CoV-2 nsp4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SARS-CoV-2 nsp4 Antibody - BSA Free and earn rewards!

Have you used SARS-CoV-2 nsp4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies