SDHD Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92372

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SDHD Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SDHD Antibody - BSA Free

Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372]

Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372]

Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372]

Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372]

Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
SDHD Antibody - BSA Free Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Staining of human placenta shows weak granular cytoplasmic positivity in trophoblastic cells.
SDHD Antibody - BSA Free Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
SDHD Antibody - BSA Free Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Immunohistochemistry: SDHD Antibody - BSA Free [NBP1-92372]

Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.

Applications for SDHD Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SDHD

SDHD is part of Complex II. Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma.

Alternate Names

CBT1, CII-4, cybS, PGL, PGL1, QPs3, SDH4, succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, Succinate dehydrogenase complex subunit D, succinate dehydrogenase complex, subunit D, integral membrane protein, succinate dehydrogenase ubiquinone cytochrome B small subunit, Succinate-ubiquinone oxidoreductase cytochrome b small subunit, Succinate-ubiquinone reductase membrane anchor subunit

Entrez Gene IDs

6392 (Human)

Gene Symbol

SDHD

UniProt

O14521 (Human)

Additional SDHD Products

Product Documents for SDHD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SDHD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SDHD Antibody - BSA Free

Customer Reviews for SDHD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SDHD Antibody - BSA Free and earn rewards!

Have you used SDHD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SDHD Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I want to use SDHD antibody (NBP1-92372) to detect mouse IHC sample, can this antibody recognize mouse epitope?

    A: NBP1-92372 has only been validated for use in human, hence we cannot guarantee the usage in mouse. If you are interested in trying this antibody in mouse you would qualify for our Innovators Reward Program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies