SEC24D Antibody (6F8S4)

Novus Biologicals | Catalog # NBP3-33280

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6F8S4
View all SEC24D Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEC24D (NP_001304995.1).

Sequence:
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SEC24D Antibody (6F8S4) (NBP3-33280) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SEC24D Antibody (6F8S4)

SEC24D Antibody (6F8S4)

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] -

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] - Western blot analysis of various lysates using SEC24D Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
SEC24D Antibody (6F8S4)

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] -

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] - Western blot analysis of lysates from NIH/3T3 cells, using SEC24D Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for SEC24D Antibody (6F8S4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SEC24D

SEC24D is encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration.

Alternate Names

FLJ43974, KIAA0755member D, SEC24 family, member D (S. cerevisiae), SEC24 related gene family, member D

Gene Symbol

SEC24D

Additional SEC24D Products

Product Documents for SEC24D Antibody (6F8S4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC24D Antibody (6F8S4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC24D Antibody (6F8S4)

There are currently no reviews for this product. Be the first to review SEC24D Antibody (6F8S4) and earn rewards!

Have you used SEC24D Antibody (6F8S4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies