SERF1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57943

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERF1A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SERF1A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SERF1A Antibody [NBP2-57943]

Immunocytochemistry/ Immunofluorescence: SERF1A Antibody [NBP2-57943]

Immunocytochemistry/Immunofluorescence: SERF1A Antibody [NBP2-57943] - Staining of human cell line HEK 293 shows localization to nuclear bodies.

Applications for SERF1A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERF1A

SERF1A is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The duplication region includes both a telomeric and a centromeric copy of this gene. Deletions of this gene, the telomeric copy, often accompany deletions of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients, and so it is thought that this gene may be a modifier of the SMA phenotype. The function of this protein is not known; however, it bears low-level homology with the RNA-binding domain of matrin-cyclophilin, a protein which colocalizes with small nuclear ribonucleoproteins (snRNPs) and the SMN1 gene product. Alternatively spliced transcripts have been documented but it is unclear whether alternative splicing occurs for both the centromeric and telomeric copies of the gene. [provided by RefSeq]

Alternate Names

FAM2B, h4F5, H4F5small EDRK-rich factor 1,4F5, Protein 4F5, SERF1, SMA modifier 1, small EDRK-rich factor 1A (telomeric), SMAM1FAM2ASERF1B, spinal muscular atrophy-related gene H4F5

Gene Symbol

SERF1A

Additional SERF1A Products

Product Documents for SERF1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERF1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SERF1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERF1A Antibody - BSA Free and earn rewards!

Have you used SERF1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies