Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-17021PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all Serpin A5/Protein C Inhibitor Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serpin A5/Protein C Inhibitor

Source: E.coli

Amino Acid Sequence: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17021It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-17021PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin A5/Protein C Inhibitor

PAI-1, PAI-2 and PAI-3 (plasminogen activator inhibitor-1, -2 and -3) are members of the serpin serine proteinase inhibitor family. PAI-1 and PAI-2 regulate uPA (urokinase-type plasminogen activator) and TPA (tissue plasminogen activator), resulting in the inhibition of proteolytic activity. Members of the serpin family generally complex with their target proteinases, then disassociate slowly into cleaved species that fold into stable inactive forms. PAI-1 can fold into the inactive state without cleavage resulting in the latent form of PAI-1. Activity can be restored to the latent form of PAI-1 through denaturation and renaturation. PAI-2 occurs in secreted and cytosolic forms through facultative polypeptide translocation. PAI-3 inhibits plasminogen activators as well as activated protein C. PAI-3 is secreted in plasma, but is also expressed in liver.

Alternate Names

PAI-3, PCI

Gene Symbol

SERPINA5

Additional Serpin A5/Protein C Inhibitor Products

Product Documents for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Serpin A5/Protein C Inhibitor Recombinant Protein Antigen and earn rewards!

Have you used Serpin A5/Protein C Inhibitor Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail