SETD6 Antibody (1Q1Z3)

Novus Biologicals | Catalog # NBP3-33343

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1Q1Z3
View all SETD6 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 310-473 of human SETD6 (NP_001153777.1).

Sequence:
TADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SETD6 Antibody (1Q1Z3)

SETD6 Antibody (1Q1Z3)

Western Blot: SETD6 Antibody (1Q1Z3) [NBP3-33343] -

Western Blot: SETD6 Antibody (1Q1Z3) [NBP3-33343] - Western blot analysis of various lysates, using SETD6 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
SETD6 Antibody (1Q1Z3)

Western Blot: SETD6 Antibody (1Q1Z3) [NBP3-33343] -

Western Blot: SETD6 Antibody (1Q1Z3) [NBP3-33343] - Western blot analysis of various lysates, using SETD6 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for SETD6 Antibody (1Q1Z3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SETD6

Alternate Names

SET domain containing 6, SET domain-containing protein 6

Gene Symbol

SETD6

Additional SETD6 Products

Product Documents for SETD6 Antibody (1Q1Z3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SETD6 Antibody (1Q1Z3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SETD6 Antibody (1Q1Z3)

There are currently no reviews for this product. Be the first to review SETD6 Antibody (1Q1Z3) and earn rewards!

Have you used SETD6 Antibody (1Q1Z3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies