SETD7/9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86803

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SETD7/9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SETD7/9. Peptide sequence: MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit SETD7/9 Antibody - BSA Free (NBP2-86803) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SETD7/9 Antibody - BSA Free

Western Blot: SETD7/9 Antibody [NBP2-86803]

Western Blot: SETD7/9 Antibody [NBP2-86803]

Western Blot: SETD7/9 Antibody [NBP2-86803] - Host: Rabbit. Target Name: SETD7. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SETD7/9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SETD7/9

Diverse signal transduction pathways impinging on the N-terminal tails of histones lead to a number of post-translational modifications including acetylation, phosphorylation, poly(ADP-ribosylation), ubiquitination and methylation. These modifications play critical roles in regulating chromatin structure and gene expression. Histone methyltransferases (HMTases) selectively methylate evolutionarily conserved arginine or lysine residues, primarily in the N-terminal tails of histones H3 and H4. Set7/9 is a histone specific HMTase that methylates histone H3 lysine 4. Set7/9 transfers methyl groups to lysine 4 of histone H3 in complex with S-adenosyl-L-methionine. Human Set7/9 is a 336 amino acid protein.

Alternate Names

EC 2.1.1.43, H3-K4-HMTase SETD7, histone H3-lysine 4-specific methyltransferase, histone-lysine N-methyltransferase SETD7, KIAA1717SET domain-containing protein 7, KMT7FLJ21193, Lysine N-methyltransferase 7, SET domain containing (lysine methyltransferase) 7, SET7/9Histone H3-K4 methyltransferase SETD7, SET7Set9, SET9

Gene Symbol

SETD7

Additional SETD7/9 Products

Product Documents for SETD7/9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SETD7/9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SETD7/9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SETD7/9 Antibody - BSA Free and earn rewards!

Have you used SETD7/9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies