SETD8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88246

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SETD8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SETD8. Peptide sequence: RAAGGKMSKPCAVEAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit SETD8 Antibody - BSA Free (NBP2-88246) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SETD8 Antibody - BSA Free

Western Blot: SETD8 Antibody [NBP2-88246]

Western Blot: SETD8 Antibody [NBP2-88246]

Western Blot: SETD8 Antibody [NBP2-88246] - Host: Rabbit. Target Name: SETD8. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1.0ug/ml

Applications for SETD8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SETD8

Histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4. H4 'Lys-20'monomethylation is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression.Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes.Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNAduring mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substratecompared to free histones

Long Name

N-lysine methyltransferase KMT5A

Alternate Names

H4-K20-HMTase KMT5A, KMT5A, PR-Set7, PR/SET07, PRSET7, SET07, SET8

Gene Symbol

KMT5A

Additional SETD8 Products

Product Documents for SETD8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SETD8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SETD8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SETD8 Antibody - BSA Free and earn rewards!

Have you used SETD8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies