SETDB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56678

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SETDB1 Antibody - BSA Free (NBP2-56678) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SETDB1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SETDB1 Antibody [NBP2-56678]

Immunocytochemistry/ Immunofluorescence: SETDB1 Antibody [NBP2-56678]

Immunocytochemistry/Immunofluorescence: SETDB1 Antibody [NBP2-56678] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
SETDB1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SETDB1 Antibody - BSA Free [NBP2-56678]

Chromatin Immunoprecipitation-exo-Seq: SETDB1 Antibody - BSA Free [NBP2-56678]

ChIP-Exo-Seq composite graph for Anti-SETDB1 (NBP2-56678) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SETDB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SETDB1

The SET domain is a highly conserved, approximately 150-amino acid motif implicated in the modulation of chromatin structure. It was originally identified as part of a larger conserved region present in the Drosophila Trithorax protein and was subsequently identified in the Drosophila Su(var)3-9 and 039;Enhancer of zeste 039 proteins, from which the acronym SET is derived. Studies have suggested that the SET domain may be a signature of proteins that modulate transcriptionally active or repressed chromatin states through chromatin remodeling activities. [supplied by OMIM]

Alternate Names

ERG-associated protein with SET domain, ESETEC 2.1.1.43, H3-K9-HMTase 4, Histone H3-K9 methyltransferase 4, histone-lysine N-methyltransferase SETDB1, histone-lysine N-methyltransferase, H3lysine-9 specific 4, KG1T, KIAA0067H3-K9-HMTase4, KMT1EERG-associated protein with a SET domain, ESET, Lysine N-methyltransferase 1E, SET domain bifurcated 1, SET domain, bifurcated 1

Gene Symbol

SETDB1

Additional SETDB1 Products

Product Documents for SETDB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SETDB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SETDB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SETDB1 Antibody - BSA Free and earn rewards!

Have you used SETDB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...