SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

Novus Biologicals | Catalog # NBP3-15736

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3G7Z3 expressed in HEK293
View all SF-1/NR5A1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human SF-1/NR5A1/Steroidogenic Factor 1 (Q13285). AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3) [NBP3-15736]

Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3) [NBP3-15736]

Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3) [NBP3-15736] - Western blot analysis of extracts of various cell lines, using SF-1/NR5A1/Steroidogenic Factor 1 antibody (NBP3-15736) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SF-1/NR5A1

Steroidogenic factor 1 (SF-1), a NR5 Fushi Tarazu-Like Receptor, has been shown to affect sexual differentiation, steroid metabolism, and neural development. SF-1 binds as a monomer and regulates all steroidogenic p450 genes, Mullerian inhibiting substance, the gonadotrophins, the ACTH receptor, oxytocin, nuclear receptor DAX-1, and several other genes. Four alternatively spliced isoforms of SF-1 have been isolated in mice, and they differ at the N and C termini but are identical in the DNA-binding domain. SF-1 expression has been documented in human brain, adrenal, spleen, liver, heart, ovary, testis, and placenta. ESTs have been isolated from human tissue libraries, including cancerous adrenal and normal lung and testis.

Long Name

Steroidogenic Factor 1

Alternate Names

AD4BP, FTZF1, NR5A1, SF1

Gene Symbol

NR5A1

Additional SF-1/NR5A1 Products

Product Documents for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)

There are currently no reviews for this product. Be the first to review SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3) and earn rewards!

Have you used SF-1/NR5A1/Steroidogenic Factor 1 Antibody (3G7Z3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies