SF3A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38200

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SF3A3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SF3A3 Antibody - BSA Free (NBP2-38200) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SF3A3 Antibody - BSA Free

Western Blot: SF3A3 Antibody [NBP2-38200]

Western Blot: SF3A3 Antibody [NBP2-38200]

Western Blot: SF3A3 Antibody [NBP2-38200] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200] - Staining in human testis and pancreas tissues using anti-SF3A3 antibody. Corresponding SF3A3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200]

Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP2-38200] - Staining of human testis shows high expression.

Applications for SF3A3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SF3A3

The SF3A3 gene encodes subunit 3 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicin

Alternate Names

PRP9, PRPF9, SAP 61, SAP61splicing factor 3a, subunit 3, 60kD, SF3a60pre-mRNA splicing factor SF3a (60kD), spliceosome associated protein 61, Spliceosome-associated protein 61, splicing factor 3A subunit 3, splicing factor 3a, subunit 3, 60kDa

Gene Symbol

SF3A3

UniProt

Q12874 (Human)

Additional SF3A3 Products

Product Documents for SF3A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SF3A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF3A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SF3A3 Antibody - BSA Free and earn rewards!

Have you used SF3A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies