SFRS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57242

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFRS3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS3(splicing factor, arginine/serine-rich 3) The peptide sequence was selected from the N terminal of SFRS3. Peptide sequence SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SFRS3 Antibody - BSA Free

Western Blot: SFRS3 Antibody [NBP1-57242]

Western Blot: SFRS3 Antibody [NBP1-57242]

Western Blot: SFRS3 Antibody [NBP1-57242] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Applications for SFRS3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS3

SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.

Alternate Names

Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20

Gene Symbol

SRSF3

UniProt

P84103 (Human)

Additional SFRS3 Products

Product Documents for SFRS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFRS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS3 Antibody - BSA Free and earn rewards!

Have you used SFRS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SFRS3 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I would like to know whether SRSF3 antibody (NBP1-57242) has been tested for immunoprecipitation and if you could give me any related suggestion. If not, do you have any SRSF3 antibody for mouse suitable for IP?

    A: Unfortunately, we have not tested this product in IP application or Mouse species yet. However, the immunogen of NBP1-57242 is 100% identical to mouse's SRSF3 and this product is expected to detect murine SRSF3.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies