SFXN2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94421

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human SFXN2 (NP_849189.1). IDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYAKKLYDSAFHPDTGEKMNVIG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SFXN2 Antibody - Azide and BSA Free (NBP2-94421) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SFXN2 Antibody - Azide and BSA Free

Western Blot: SFXN2 AntibodyAzide and BSA Free [NBP2-94421]

Western Blot: SFXN2 AntibodyAzide and BSA Free [NBP2-94421]

Western Blot: SFXN2 Antibody [NBP2-94421] - Western blot analysis of extracts of various cell lines, using SFXN2 antibody (NBP2-94421) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
SFXN2 Antibody - Azide and BSA Free

Western Blot: SFXN2 Antibody - Azide and BSA Free [NBP2-94421] -

Western Blot: SFXN2 Antibody - Azide and BSA Free [NBP2-94421] - Western blot analysis of various lysates using SFXN2 Rabbit pAb (A17817) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Applications for SFXN2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SFXN2

Potential iron transporter

Alternate Names

sideroflexin 2, sideroflexin-2

Gene Symbol

SFXN2

Additional SFXN2 Products

Product Documents for SFXN2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFXN2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SFXN2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SFXN2 Antibody - Azide and BSA Free and earn rewards!

Have you used SFXN2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...