SHB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58355

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SHB Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SHB(Src homology 2 domain containing adaptor protein B) The peptide sequence was selected from the N terminal of SHB. Peptide sequence ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SHB Antibody - BSA Free

Western Blot: SHB Antibody [NBP1-58355]

Western Blot: SHB Antibody [NBP1-58355]

Western Blot: SHB Antibody [NBP1-58355] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for SHB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHB

SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Long Name

Src Homology 2 Domain Containing Adaptor Protein B

Alternate Names

bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B

Gene Symbol

SHB

UniProt

Q15464 (Human)

Additional SHB Products

Product Documents for SHB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHB Antibody - BSA Free and earn rewards!

Have you used SHB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

VEGF - VEGF R2 Signaling Pathways VEGF - VEGF R2 Signaling Pathway Thumbnail