Siglec-10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59247

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Siglec-10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SIGLEC10(sialic acid binding Ig-like lectin 10) The peptide sequence was selected from the middle region of SIGLEC10. Peptide sequence CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Siglec-10 Antibody - BSA Free

Western Blot: Siglec-10 Antibody [NBP1-59247]

Western Blot: Siglec-10 Antibody [NBP1-59247]

Western Blot: SIGLEC10 Antibody [NBP1-59247] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Applications for Siglec-10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Siglec-10

SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-653 AC008750.9 90495-91147 c 654-760 DA387605.1 391-497 761-2959 AF301007.1 262-2460 2960-3794 AY358337.1 1930-2764

Long Name

Sialic Acid Binding Ig-like Lectin 10

Alternate Names

Siglec10, SLG2

Gene Symbol

SIGLEC10

UniProt

Q96LC7

Additional Siglec-10 Products

Product Documents for Siglec-10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Siglec-10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Siglec-10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Siglec-10 Antibody - BSA Free and earn rewards!

Have you used Siglec-10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies