SIRP gamma/CD172g Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82342

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SIRP gamma/CD172g Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SIRP gamma. Peptide sequence: ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SIRP gamma/CD172g Antibody - BSA Free (NBP2-82342) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SIRP gamma/CD172g Antibody - BSA Free

Western Blot: SIRP gamma/CD172g Antibody [NBP2-82342]

Western Blot: SIRP gamma/CD172g Antibody [NBP2-82342]

Western Blot: SIRP gamma/CD172g Antibody [NBP2-82342] - WB Suggested Anti-SIRPG Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for SIRP gamma/CD172g Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIRP gamma/CD172g

CD172 gamma is encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.

Long Name

Signal-regulatory Protein gamma

Alternate Names

CD172g, SIRP beta 2, SIRPG

Gene Symbol

SIRPG

Additional SIRP gamma/CD172g Products

Product Documents for SIRP gamma/CD172g Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIRP gamma/CD172g Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

T Cell Migration/Adhesion

Customer Reviews for SIRP gamma/CD172g Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIRP gamma/CD172g Antibody - BSA Free and earn rewards!

Have you used SIRP gamma/CD172g Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies