SLC13A3/NaDC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69630

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC13A3/NaDC3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the N terminal of SLC13A3 (NP_073740). Peptide sequence MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC13A3/NaDC3 Antibody - BSA Free

Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630]

Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630]

Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630] - This Anti-SLC13A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Applications for SLC13A3/NaDC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC13A3/NaDC3

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.

Long Name

Solute Carrier Family 13 (Sodium/Sulfate Symporters), Member 3

Alternate Names

NaDC3, SDCT2

Entrez Gene IDs

64849 (Human)

Gene Symbol

SLC13A3

UniProt

Q8WWT9 (Human)

Additional SLC13A3/NaDC3 Products

Product Documents for SLC13A3/NaDC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC13A3/NaDC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glial Lineage Markers

Customer Reviews for SLC13A3/NaDC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC13A3/NaDC3 Antibody - BSA Free and earn rewards!

Have you used SLC13A3/NaDC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies