SLC22A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94224

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC22A11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human SLC22A11 (NP_060954.1). FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC22A11 Antibody - BSA Free

Western Blot: SLC22A11 AntibodyAzide and BSA Free [NBP2-94224]

Western Blot: SLC22A11 AntibodyAzide and BSA Free [NBP2-94224]

Western Blot: SLC22A11 Antibody [NBP2-94224] - Western blot analysis of extracts of various cell lines, using SLC22A11 antibody (NBP2-94224) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for SLC22A11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC22A11

The protein encoded by the SLC22A11 gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. [provided by RefSeq]

Alternate Names

hOAT4, MGC34282, OAT4solute carrier family 22 (organic anion/cation transporter), member 11, Organic anion transporter 4, solute carrier family 22 (organic anion/urate transporter), member 11, solute carrier family 22 member 11

Gene Symbol

SLC22A11

Additional SLC22A11 Products

Product Documents for SLC22A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC22A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A11 Antibody - BSA Free and earn rewards!

Have you used SLC22A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies