SLC23A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59384

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC23A2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC23A2(solute carrier family 23 (nucleobase transporters), member 2) The peptide sequence was selected from the middle region of SLC23A2. Peptide sequence VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC23A2 Antibody - BSA Free

Western Blot: SLC23A2 Antibody [NBP1-59384]

Western Blot: SLC23A2 Antibody [NBP1-59384]

Western Blot: SLC23A2 Antibody [NBP1-59384] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.

Applications for SLC23A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC23A2

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Alternate Names

KIAA0238SLC23A1, Na(+)/L-ascorbic acid transporter 2, Nucleobase transporter-like 1 protein, Sodium-dependent vitamin C transporter 2, sodium-dependent vitamin C transporter-2, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 2, SVCT2NBTL1, Yolk sac permease-like molecule 2, YSPL2hSVCT2

Gene Symbol

SLC23A2

UniProt

Q9UGH3 (Human)

Additional SLC23A2 Products

Product Documents for SLC23A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC23A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC23A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC23A2 Antibody - BSA Free and earn rewards!

Have you used SLC23A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies