SLC25A12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88288

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC25A12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC25A12. Peptide sequence: RINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC25A12 Antibody - BSA Free

Western Blot: SLC25A12 Antibody [NBP2-88288]

Western Blot: SLC25A12 Antibody [NBP2-88288]

Western Blot: SLC25A12 Antibody [NBP2-88288] - Host: Rabbit. Target Name: SLC25A13. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC25A12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A12

The SLC25A12 gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding thi

Alternate Names

AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12

Gene Symbol

SLC25A12

Additional SLC25A12 Products

Product Documents for SLC25A12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A12 Antibody - BSA Free and earn rewards!

Have you used SLC25A12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies