SLC26A6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88292

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC26A6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SLC26A6. Peptide sequence: VNTSLEDMRSNNVEDCKMMVSSGDKMEDATANGQEDSKAPDGSTLKALGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC26A6 Antibody - BSA Free

Western Blot: SLC26A6 Antibody [NBP2-88292]

Western Blot: SLC26A6 Antibody [NBP2-88292]

Western Blot: SLC26A6 Antibody [NBP2-88292] - WB Suggested Anti-SLC26A6 Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole Cell

Applications for SLC26A6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A6

SLC26A6 belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Several alternatively spliced transcript variants of this gene, encoding distinct isoforms, have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Alternate Names

anion transporter 1, DKFZp586E1422, pendrin L1, Pendrin-L1, Pendrin-like protein 1, solute carrier family 26 member 6, solute carrier family 26, member 6, sulfate anion transporter

Gene Symbol

SLC26A6

Additional SLC26A6 Products

Product Documents for SLC26A6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC26A6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC26A6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC26A6 Antibody - BSA Free and earn rewards!

Have you used SLC26A6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies