SLC2A4RG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57221

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC2A4RG Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SLC2A4RG Antibody [NBP2-57221]

Immunocytochemistry/ Immunofluorescence: SLC2A4RG Antibody [NBP2-57221]

Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody [NBP2-57221] - Staining of human cell line MCF7 shows localization to nuclear speckles.
SLC2A4RG Antibody - BSA Free Chromatin Immunoprecipitation ChIP: SLC2A4RG Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: SLC2A4RG Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-SLC2A4RG tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for SLC2A4RG Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC2A4RG

SLC2A4RG is encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.

Alternate Names

GEFHDBP-1, HDBP1GLUT4 enhancer factor, Huntington disease gene regulatory region-binding protein 1, Huntington's disease gene regulatory region-binding protein 1, Si-1-2, Si-1-2-19, SLC2A4 regulator

Gene Symbol

SLC2A4RG

Additional SLC2A4RG Products

Product Documents for SLC2A4RG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC2A4RG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC2A4RG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC2A4RG Antibody - BSA Free and earn rewards!

Have you used SLC2A4RG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...