SLC35C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85749

Novus Biologicals
Discontinued Product
NBP2-85749 has been discontinued. View all SLC35C1 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC35C1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35C1. Peptide sequence: VNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC35C1 Antibody - BSA Free

Western Blot: SLC35C1 Antibody [NBP2-85749]

Western Blot: SLC35C1 Antibody [NBP2-85749]

Western Blot: SLC35C1 Antibody [NBP2-85749] - Host: Rabbit. Target Name: SLC35C1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC35C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC35C1

The SLC35C1 gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. (provi

Alternate Names

CDG2C, FLJ11320, FLJ14841, FUCT1GDP-fucose transporter 1, Solute carrier family 35 member C1, solute carrier family 35, member C1

Gene Symbol

SLC35C1

Additional SLC35C1 Products

Product Documents for SLC35C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC35C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC35C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC35C1 Antibody - BSA Free and earn rewards!

Have you used SLC35C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies