SLC35D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09954

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC35D1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human S35D1. Peptide sequence GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC35D1 Antibody - BSA Free

Western Blot: SLC35D1 Antibody [NBP3-09954]

Western Blot: SLC35D1 Antibody [NBP3-09954]

Western Blot: SLC35D1 Antibody [NBP3-09954] - Western blot analysis of SLC35D1 in Ovary Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for SLC35D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC35D1

Glycosylation of cellular glycoconjugates occurs in the endoplasmic reticulum (ER) and Golgi compartment, and requires transport of nucleotide sugars from the cytosol into the lumen of the ER and Golgi by specific transporters. The protein encoded by this gene resides in the ER, and transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to the ER lumen. It may participate in glucuronidation and/or chondroitin sulfate biosynthesis. Mutations in this gene are associated with Schneckenbecken dysplasia.

Alternate Names

KIAA0260MGC138236, solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dualtransporter), member D1, Solute carrier family 35 member D1, UDP-galactose transporter-related protein 7, UDP-GlcA/UDP-GalNAc transporter, UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter, UGTrel7, UGTREL7UDP-galactose transporter-related 7

Gene Symbol

SLC35D1

Additional SLC35D1 Products

Product Documents for SLC35D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC35D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC35D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC35D1 Antibody - BSA Free and earn rewards!

Have you used SLC35D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies