SLC39A5 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-04949
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 305-385 of human SLC39A5 (NP_775867.2). LGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITW
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SLC39A5 Antibody - Azide and BSA Free
Western Blot: SLC39A5 Antibody - Azide and BSA Free [NBP3-04949] -
Glucose is the main driver of sucrose-induced dysregulation of intestinal epithelial barrier function. (A) Following 24 h of glucose (G), fructose (F), and GF treatments, FITC-Dextran (green) fluorescence intensity within the enteroid was quantified by software ImageJ. Values are means +/- SEM; # of enteroid counted: mock, n = 322; GF, n = 293; G, n = 278; F, n = 253. One-way ANOVA. (B) Representative western analyses from two independent experiments showed ZIP14, ZIP4, and ZIP5 transporters. (C) Cellular location of ZIP14 at the basalateral side of the intestinal epithelium was shown in the mouse enteroid system. Images were obtained using Zeiss LSM880 confocal inverted microscope. Green: DAPI; red: ZIP14. (D) Depiction of the proposed mechanism of G or F-induced permeability. (E) Following 24 h of glucose (G) alone or combined with zinc treatments, FITC-Dextran (green) fluorescence intensity within the enteroid was quantified by software ImageJ. Values are means +/- SEM; # of enteroid counted: (G), n = 102; G + zinc (Zn), n = 111. (F) Zinc levels in intestinal epithelial cells were measured by MP-AES. (G,H) Intestinal permeability was assessed by FITC-Dextran and western blot analysis for TJP. Following 8 weeks of sucrose treatment the body weight (I) % body fat (J) and blood glucose levels were measured from floxed control and intestine-specific Zip14 KO (IKO-ZIP14 is deleted from villin-expressing cells) mice. Values are means +/- SEM. n = 6–8 mice per group. The unpaired t-test between sucrose-treated floxed and IKO mice. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37637953), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SLC39A5 Antibody - Azide and BSA Free [NBP3-04949] -
Subchronic liquid sucrose treatment alters intestinal zinc metabolism. (A) Zinc concentration in intestinal epithelial cells (IEC) using MP-AES. IECs were separated and digested in nitric acid. Total protein concentrations were used for normalization. (B,C) Following the morning fast, mice were administered 65Zn via either gavage (B) or subcutaneous injection (C). Three hours later, the amount of radioactivity in intestine tissue was measured. (D) Representative western analyses show intestinal ZIP5 and ZIP14 protein levels from control and sucrose-fed mice (n = 3 mice per group). (E) Depiction of proposed intestinal zinc transporter and zinc regulation based on the data in A–D. Values are means +/- SEM; n = 4–7. Unpaired t-test between control and sucrose-treated groups. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37637953), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SLC39A5 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: SLC39A5
Alternate Names
LZT-Hs7, MGC34778, solute carrier family 39 (metal ion transporter), member 5, Solute carrier family 39 member 5, zinc transporter ZIP5, ZIP5, ZIP-5, Zrt- and Irt-like protein 5
Gene Symbol
SLC39A5
Additional SLC39A5 Products
Product Documents for SLC39A5 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC39A5 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for SLC39A5 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SLC39A5 Antibody - Azide and BSA Free and earn rewards!
Have you used SLC39A5 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...