SLC7A7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59856

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC7A7 Antibody - BSA Free

Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856]

Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
SLC7A7 Antibody - BSA Free

Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -

Expression level changes following overexpression and interference of SLC7A7 in PSCs. (A) The mRNA expression level of SLC7A7 after overexpression of SLC7A7; (B) the mRNA expression level of SLC7A7 after interference of SLC7A7; (C) protein expression level of SLC7A7 after overexpression of SLC7A7; (D) Quantification of Western blotting after overexpression of SLC7A7; (E) the protein expression level of SLC7A7 after interference of SLC7A7; (F) quantification of Western blotting after interference of SLC7A7. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLC7A7 Antibody - BSA Free

Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -

Expression level changes following overexpression and interference of SLC7A7 in PSCs. (A) The mRNA expression level of SLC7A7 after overexpression of SLC7A7; (B) the mRNA expression level of SLC7A7 after interference of SLC7A7; (C) protein expression level of SLC7A7 after overexpression of SLC7A7; (D) Quantification of Western blotting after overexpression of SLC7A7; (E) the protein expression level of SLC7A7 after interference of SLC7A7; (F) quantification of Western blotting after interference of SLC7A7. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLC7A7 Antibody - BSA Free

Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -

Effect of GCs on the amino acid transporter SLC7A7. (A) The mRNA expression levels of SLC7A7 in longissimus dorsi muscle of the cortisol group and the control group, respectively; (B) the mRNA expression levels of SLC7A7 after DEX treatment for 24 h and 48 h; (C) the protein expression levels of SLC7A7 after DEX treatment; (D): quantification of Western blotting under the treatment of DEX; (E) validation of m6A modification in SLC7A7 mRNA by MeRIP-QPCR; (F) the mRNA expression of SLC7A7 was detected at 0, 2 and 4 h after ActD treatment; (G) Dot blot detection of m6A modification levels after treatment with 0, 50, 100 and 200 μM DAA; (H) the mRNA expression level of SLC7A7 after treatment with 0, 50, 100 and 200 μM DAA; (I) the protein expression levels of SLC7A7 after treatment with 200 μM DAA; (J) quantification of Western blotting under the treatment of DAA. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SLC7A7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC7A7

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.

Long Name

Solute Carrier Family 7 Member 7

Alternate Names

LAT3, LPI, MOP-2, Y+LAT1

Gene Symbol

SLC7A7

UniProt

Additional SLC7A7 Products

Product Documents for SLC7A7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC7A7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SLC7A7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC7A7 Antibody - BSA Free and earn rewards!

Have you used SLC7A7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...