SLK Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25147PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLK

Source: E.coli

Amino Acid Sequence: KEPEVTVVSQPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25147It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25147PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLK

The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene was only detected in retina and brain. Study of the mouse homolog demonstrated that groups of cells expressing this protein are located in the center or inner border of the inner unclear layer of retina. Three alternatively spliced variants encoding different isoforms have been described.

Alternate Names

bA16H23.1, CTCL tumor antigen se20-9, EC 2.7.11, EC 2.7.11.1, hSLK, KIAA0204LOSK, Long Ste20-like Kinase, se20-9, Serine/threonine-protein kinase 2, SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase, SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase (yeast), SNF1 sucrose nonfermenting like kinase, STE20-like kinaseSTE20-like kinase (yeast), STE20-like serine/threonine-protein kinase, STE20-related kinase, Ste20-related serine/threonine kinase, STE20-related serine/threonine-protein kinase, STK2MGC133067

Gene Symbol

SLK

Additional SLK Products

Product Documents for SLK Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLK Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for SLK Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review SLK Recombinant Protein Antigen and earn rewards!

Have you used SLK Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...