SLURP1 Antibody (4D1) - Azide and BSA Free

Novus Biologicals | Catalog # H00057152-M06

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry-Frozen, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4D1

Format

Azide and BSA Free
View all SLURP1 Primary Antibodies »

Product Specifications

Immunogen

SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE

Reactivity Notes

Other species not tested.

Specificity

SLURP1 - secreted LY6/PLAUR domain containing 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SLURP1 Antibody (4D1) - Azide and BSA Free

Western Blot: SLURP1 Antibody (4D1) [H00057152-M06]

Western Blot: SLURP1 Antibody (4D1) [H00057152-M06]

Western Blot: SLURP1 Antibody (4D1) [H00057152-M06] - Analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody (M06), clone 4D1. Lane 1: SLURP1 transfected lysatE (11.2 KDa). Lane 2: Non-transfected lysate.
ELISA: SLURP1 Antibody (4D1) [H00057152-M06]

ELISA: SLURP1 Antibody (4D1) [H00057152-M06]

ELISA: SLURP1 Antibody (4D1) [H00057152-M06] - Detection limit for recombinant GST tagged SLURP1 is approximately 0.1ng/ml as a capture antibody.
Immunoprecipitation: SLURP1 Antibody (4D1) [H00057152-M06]

Immunoprecipitation: SLURP1 Antibody (4D1) [H00057152-M06]

Immunoprecipitation: SLURP1 Antibody (4D1) [H00057152-M06] - Analysis of SLURP1 transfected lysate using anti-SLURP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SLURP1 rabbit polyclonal antibody.

Applications for SLURP1 Antibody (4D1) - Azide and BSA Free

Application
Recommended Usage

ELISA

1:100-1:2000

Immunoprecipitation

1:10-1:1000

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLURP1

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors.

Long Name

Secreted Ly-6/uPAR-related Protein 1

Alternate Names

ARS Component B

Entrez Gene IDs

57152 (Human)

Gene Symbol

SLURP1

OMIM

248300 (Human)

UniProt

NP_065160 (Human)

Additional SLURP1 Products

Product Documents for SLURP1 Antibody (4D1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLURP1 Antibody (4D1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLURP1 Antibody (4D1) - Azide and BSA Free

Customer Reviews for SLURP1 Antibody (4D1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLURP1 Antibody (4D1) - Azide and BSA Free and earn rewards!

Have you used SLURP1 Antibody (4D1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies