SMC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58330

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SMC3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMC3 Antibody - BSA Free

Western Blot: SMC3 Antibody [NBP2-58330]

Western Blot: SMC3 Antibody [NBP2-58330]

Western Blot: SMC3 Antibody [NBP2-58330] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMC3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: SMC3 Antibody [NBP2-58330]

Immunocytochemistry/ Immunofluorescence: SMC3 Antibody [NBP2-58330]

Immunocytochemistry/Immunofluorescence: SMC3 Antibody [NBP2-58330] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for SMC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMC3

Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis and in chromosome movement.

Alternate Names

Bamacan, BAMSMC protein 3, Basement membrane-associated chondroitin proteoglycan, BMH, Chondroitin sulfate proteoglycan 6, chondroitin sulfate proteoglycan 6 (bamacan), Chromosome-associated polypeptide, CSPG6structural maintenance of chromosomes protein 3, hCAP, HCAPbamacan, SMC-3, SMC3L1CDLS3, structural maintenance of chromosomes 3

Gene Symbol

SMC3

Additional SMC3 Products

Product Documents for SMC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC3 Antibody - BSA Free and earn rewards!

Have you used SMC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies