SMURF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SMURF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMURF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SMURF1 Antibody [NBP3-17934]

Immunocytochemistry/ Immunofluorescence: SMURF1 Antibody [NBP3-17934]

Immunocytochemistry/Immunofluorescence: SMURF1 Antibody [NBP3-17934] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
SMURF1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SMURF1 Antibody - BSA Free [NBP3-17934]

Chromatin Immunoprecipitation-exo-Seq: SMURF1 Antibody - BSA Free [NBP3-17934]

ChIP-Exo-Seq composite graph for Anti-SMURF1 (NBP3-17934) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SMURF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMURF1

SMURF1 encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined.

Long Name

SMAD Ubiquitination Regulatory Factor 1

Alternate Names

EC 6.3.2, KIAA1625

Gene Symbol

SMURF1

Additional SMURF1 Products

Product Documents for SMURF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMURF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMURF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMURF1 Antibody - BSA Free and earn rewards!

Have you used SMURF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies