SNAP29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69180

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNAP29 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SNAP29 (synaptosomal-associated protein, 29kDa) The peptide sequence was selected from the middle region of SNAP29. Peptide sequence QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SNAP29 Antibody - BSA Free

Western Blot: SNAP29 Antibody [NBP1-69180]

Western Blot: SNAP29 Antibody [NBP1-69180]

Western Blot: SNAP29 Antibody [NBP1-69180] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for SNAP29 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNAP29

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.

Long Name

Synaptosomal-associated Protein, 29 kDa

Alternate Names

CEDNIK

Gene Symbol

SNAP29

UniProt

O95721 (Human)

Additional SNAP29 Products

Product Documents for SNAP29 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNAP29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNAP29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNAP29 Antibody - BSA Free and earn rewards!

Have you used SNAP29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies