SPAM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83579

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPAM1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPAM1. Peptide sequence: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPAM1 Antibody - BSA Free

Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579] - Host: Rabbit. Target Name: SPAM1. Sample Type: 293T. Antibody Dilution: 1.0ug/ml
Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579] - WB Suggested Anti-SPAM1 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579]

Western Blot: SPAM1 Antibody [NBP2-83579] - Host: Rabbit. Target Name: SPAM1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Applications for SPAM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPAM1

Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Long Name

Sperm Adhesion Molecule 1

Alternate Names

HYA1, HYAL3, HYAL5, PH20, SPAG15

Gene Symbol

SPAM1

Additional SPAM1 Products

Product Documents for SPAM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPAM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPAM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPAM1 Antibody - BSA Free and earn rewards!

Have you used SPAM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies