The Coronavirus Spike protein (S Protein) is one of four major structural proteins (S, M, E, N) present in each viral particle. Spike proteins are abundantly expressed on the surface forming its characteristic crown-like halo structure. The Spike protein is a highly glycosylated, type I transmembrane protein that plays a critical role in receptor recognition and host cell entry. There are two subunits, S1 and S2, that divide the protein roughly in half. Within the N-terminal S1 subunit is the N-terminal domain and receptor binding domain (Spike RBD protein). The Spike RBD binds to the host cell and undergoes several conformational changes and proteolysis leading to fusion of the virus particle to the host cell membrane allowing transfer of the nucleocapsid into the host cell cytoplasm. For SARS-CoV-2, the virus responsible for the COVID-19 pandemic, the Spike RBD tightly associates with human ACE-2. Recombinant SARS-CoV-2 proteins and antibodies that recognize these proteins are essential for studying the molecular mechanisms of the coronavirus life cycle.
Spike Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-37899
Loading...
Key Product Details
Species Reactivity
SARS-CoV
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (NP_828851.1).
Sequence:
DVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNF
Sequence:
DVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Spike Antibody - BSA Free
Western Blot: Spike Antibody [NBP3-37899] -
Western Blot: Spike Antibody [NBP3-37899] - Western blot analysis of various lysates using Spike Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Applications for Spike Antibody - BSA Free
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Spike
Long Name
Spike Protein
Alternate Names
S Protein
Additional Spike Products
Product Documents for Spike Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Spike Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Spike Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Spike Antibody - BSA Free and earn rewards!
Have you used Spike Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...