Spike Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37899

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

SARS-CoV

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (NP_828851.1).

Sequence:
DVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Spike Antibody - BSA Free

Spike Antibody

Western Blot: Spike Antibody [NBP3-37899] -

Western Blot: Spike Antibody [NBP3-37899] - Western blot analysis of various lysates using Spike Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for Spike Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Spike

The Coronavirus Spike protein (S Protein) is one of four major structural proteins (S, M, E, N) present in each viral particle. Spike proteins are abundantly expressed on the surface forming its characteristic crown-like halo structure. The Spike protein is a highly glycosylated, type I transmembrane protein that plays a critical role in receptor recognition and host cell entry. There are two subunits, S1 and S2, that divide the protein roughly in half. Within the N-terminal S1 subunit is the N-terminal domain and receptor binding domain (Spike RBD protein). The Spike RBD binds to the host cell and undergoes several conformational changes and proteolysis leading to fusion of the virus particle to the host cell membrane allowing transfer of the nucleocapsid into the host cell cytoplasm. For SARS-CoV-2, the virus responsible for the COVID-19 pandemic, the Spike RBD tightly associates with human ACE-2. Recombinant SARS-CoV-2 proteins and antibodies that recognize these proteins are essential for studying the molecular mechanisms of the coronavirus life cycle.

Long Name

Spike Protein

Alternate Names

S Protein

Additional Spike Products

Product Documents for Spike Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Spike Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Spike Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Spike Antibody - BSA Free and earn rewards!

Have you used Spike Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...