Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57324

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Splicing factor, arginine/serine-rich 11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-57324]

Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-57324]

Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-57324] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Splicing factor, arginine/serine-rich 11

SFRS11 is 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.This gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.

Alternate Names

Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11

Gene Symbol

SRSF11

UniProt

Q05519 (Human)

Additional Splicing factor, arginine/serine-rich 11 Products

Product Documents for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Splicing factor, arginine/serine-rich 11 Antibody - BSA Free and earn rewards!

Have you used Splicing factor, arginine/serine-rich 11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies