SPO11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58172

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Spo11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23525040).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SPO11 Antibody - BSA Free

Western Blot: SPO11 Antibody [NBP1-58172]

Western Blot: SPO11 Antibody [NBP1-58172]

Western Blot: SPO11 Antibody [NBP1-58172] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: SPO11 Antibody [NBP1-58172]

Western Blot: SPO11 Antibody [NBP1-58172]

Western Blot: SPO11 Antibody [NBP1-58172] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for SPO11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Spo11

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family. Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Alternate Names

Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like

Gene Symbol

SPO11

UniProt

Q9Y5K1 (Human)

Additional Spo11 Products

Product Documents for SPO11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SPO11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SPO11 Antibody - BSA Free

Customer Reviews for SPO11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPO11 Antibody - BSA Free and earn rewards!

Have you used SPO11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies