SRC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57610

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (93%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SRC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SRC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SRC1 Antibody [NBP2-57610]

Immunocytochemistry/ Immunofluorescence: SRC1 Antibody [NBP2-57610]

Immunocytochemistry/Immunofluorescence: SRC1 Antibody [NBP2-57610] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
SRC1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SRC1 Antibody - BSA Free [NBP2-57610]

Chromatin Immunoprecipitation-exo-Seq: SRC1 Antibody - BSA Free [NBP2-57610]

ChIP-Exo-Seq composite graph for Anti-NCOA1 (NBP2-57610) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SRC1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRC1

Steroid and thyroid hormones and retinoic acid regulate a complex array of gene expression activity via intracellular receptor transcription factors belonging to the ligand dependent nuclear receptor superfamily. Adding to the complexity of function of these transcription factors are associated proteins known as coactivators and corepressors which, as their names suggest, enhance or depress transcriptional activity of the nuclear receptor with which they associate. One such coactivator is Steroid Receptor Coactivator-1 (SRC 1).SRC 1 has been shown to interact with and stimulate the transcriptional activity of estrogen, progesterone, retinoic acid, thyroid and glucocorticoid receptors, as well as retinoic X receptor (RXR) in a ligand dependent manner. The amino terminal region of SRC 1 contains a PAS-A-basic helix-loop-helix homology domain which has previously been shown to be dimerization domains in other nuclear transcription factors including the aryl hydrocarbon (Ah) receptor and its heterodimerization partner, ARNT. The carboxy-terminal region of SRC 1 has been shown to possess histone acetyltransferase activity specific primarily for histones H3 & H4.

Long Name

Nuclear receptor coactivator 1

Alternate Names

bHLHe74, NCoA-1, NCOA1, Protein Hin-2, RIP160

Gene Symbol

NCOA1

Additional SRC1 Products

Product Documents for SRC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SRC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRC1 Antibody - BSA Free and earn rewards!

Have you used SRC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies