SRY Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82349

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SRY. Peptide sequence: SEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SRY Antibody - BSA Free

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - Host: Rabbit. Target Name: SRY. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - WB Suggested Anti-SRY Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - Host: Rabbit. Target Name: SRY. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlSRY is supported by BioGPS gene expression data to be expressed in 721_B

Applications for SRY Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRY

SRY encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Alternate Names

essential protein for sex determination in human males, sex determining region Y, sex-determining region on Y, sex-determining region Y protein, TDFsex determining region protein, TDY, Testis-determining factor

Gene Symbol

SRY

Additional SRY Products

Product Documents for SRY Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRY Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRY Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRY Antibody - BSA Free and earn rewards!

Have you used SRY Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...