ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62558

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected form the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [NBP1-62558]

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [NBP1-62558]

Western Blot: ST3GAL2 Antibody [NBP1-62558] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Long Name

ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2

Alternate Names

Alpha 2,3-ST 2, Sialyltransferase 4B, SIAT4B, ST3GalA.2

Gene Symbol

ST3GAL2

OMIM

NP_008858 (Human)

UniProt

Q16842 (Human)

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews

There are currently no reviews for this product. Be the first to review ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free and earn rewards!

Have you used ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies