ST3GAL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60067

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ST3GAL3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST3GAL3. Peptide sequence GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ST3GAL3 Antibody - BSA Free

Western Blot: ST3GAL3 Antibody [NBP1-60067]

Western Blot: ST3GAL3 Antibody [NBP1-60067]

Western Blot: ST3GAL3 Antibody [NBP1-60067] - Human Muscle lysate, concentration 1.25ug/ml.

Applications for ST3GAL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ST3GAL3

ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Long Name

ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3

Alternate Names

MRT12, Siat3, SIAT6, ST3 beta-Gal alpha-2,3-Sialyltransferase 3, St3Gal-III, ST3GalIII, ST3N

Gene Symbol

ST3GAL3

Additional ST3GAL3 Products

Product Documents for ST3GAL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ST3GAL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ST3GAL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ST3GAL3 Antibody - BSA Free and earn rewards!

Have you used ST3GAL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies