STRAP Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-38757PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRAP.

Source: E. coli

Amino Acid Sequence: FNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38757.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-38757PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: STRAP

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex

Alternate Names

MAP activator with WD repeats, MAWDpt-wd, serine/threonine kinase receptor associated protein, serine-threonine kinase receptor-associated protein, UNR-interacting protein, UNRIPPT-WD, WD-40 repeat protein PT-WD

Gene Symbol

STRAP

Additional STRAP Products

Product Documents for STRAP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STRAP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for STRAP Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review STRAP Recombinant Protein Antigen and earn rewards!

Have you used STRAP Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for STRAP Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking to buy an antibody for STRAP (serine-threonine receptor associated protein) and was wondering if you had published references related to the use of your STRAP antibodies. My application would be for Western blot.

    A: Unfortunately, we do not have any published references related to the use of our STRAP antibodies yet. The antibodies were tested and validated and the images published on our website are in house images. If you would like me to help you choose an antibody that would be the best choice for your purposes please let me know what species you are working with. I also wanted to mention our 100% Novus Guarantee to you. We guarantee that the antibody you will use will work in species and application we have validated it in. If you experience any troubles, we will be happy to troubleshoot with you. However, should we fail to resolve your problems we will refund your purchase or replace the antibody with a more appropriate substitute.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...