STT3B Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93315

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all STT3B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STT3B (NP_849193.1). MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for STT3B Antibody - Azide and BSA Free

STT3B Antibody - Azide and BSA Free

Western Blot: STT3B Antibody - Azide and BSA Free [NBP2-93315] -

Western Blot: STT3B Antibody - Azide and BSA Free [NBP2-93315] - Western blot analysis of lysates from HUH-7 cells, using STT3B Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for STT3B Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: STT3B

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]

Alternate Names

FLJ90106, homolog of yeast STT3, Oligosaccharyl transferase subunit STT3B, SIMPEC 2.4.1.119, source of immunodominant MHC associated peptides, Source of immunodominant MHC-associated peptides homolog, STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae), STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Gene Symbol

STT3B

Additional STT3B Products

Product Documents for STT3B Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STT3B Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for STT3B Antibody - Azide and BSA Free

Customer Reviews for STT3B Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review STT3B Antibody - Azide and BSA Free and earn rewards!

Have you used STT3B Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies