Suppressor of Ty 4 homolog 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86835

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Suppressor of Ty 4 homolog 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Suppressor of Ty 4 homolog 1. Peptide sequence: NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Suppressor of Ty 4 homolog 1 Antibody - BSA Free

Western Blot: Suppressor of Ty 4 homolog 1 Antibody [NBP2-86835]

Western Blot: Suppressor of Ty 4 homolog 1 Antibody [NBP2-86835]

Western Blot: Suppressor of Ty 4 homolog 1 Antibody [NBP2-86835] - WB Suggested Anti-SUPT4H1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Applications for Suppressor of Ty 4 homolog 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Suppressor of Ty 4 homolog 1

Suppressor of Ty 4 homolog 1 is a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGT

Alternate Names

DRB sensitivity-inducing factor 14 kDa subunit, DRB sensitivity-inducing factor small subunit, DSIF p14, DSIF small subunit, SPT4, SPT4HhSPT4, suppressor of Ty (S.cerevisiae) 4 homolog 1, suppressor of Ty 4 homolog 1 (S. cerevisiae), SUPT4H, transcription elongation factor SPT4

Gene Symbol

SUPT4H1

Additional Suppressor of Ty 4 homolog 1 Products

Product Documents for Suppressor of Ty 4 homolog 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Suppressor of Ty 4 homolog 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Suppressor of Ty 4 homolog 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Suppressor of Ty 4 homolog 1 Antibody - BSA Free and earn rewards!

Have you used Suppressor of Ty 4 homolog 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies