SUZ12 Antibody (1M3V2)

Novus Biologicals | Catalog # NBP3-16383

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1M3V2 expressed in HEK293
View all SUZ12 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022). MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SUZ12 Antibody (1M3V2) (NBP3-16383) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SUZ12 Antibody (1M3V2)

Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383]

Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383]

Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383]

Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383]

Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 30s.

Applications for SUZ12 Antibody (1M3V2)

Application
Recommended Usage

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUZ12

This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. [provided by RefSeq]

Long Name

Suppressor of Zeste 12 Homolog

Alternate Names

CHET9, JJAZ1

Gene Symbol

SUZ12

Additional SUZ12 Products

Product Documents for SUZ12 Antibody (1M3V2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SUZ12 Antibody (1M3V2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics

Customer Reviews for SUZ12 Antibody (1M3V2)

There are currently no reviews for this product. Be the first to review SUZ12 Antibody (1M3V2) and earn rewards!

Have you used SUZ12 Antibody (1M3V2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies