TAF10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85867

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TAF10. Peptide sequence: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TAF10 Antibody - BSA Free

Western Blot: TAF10 Antibody [NBP2-85867]

Western Blot: TAF10 Antibody [NBP2-85867]

Western Blot: TAF10 Antibody [NBP2-85867] - WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate
Western Blot: TAF10 Antibody [NBP2-85867]

Western Blot: TAF10 Antibody [NBP2-85867]

Western Blot: TAF10 Antibody [NBP2-85867] - Host: Mouse. Target Name: TAF10. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Applications for TAF10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF10

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs.

Alternate Names

30kDa, STAF28, TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2ATAFII-30, TAF2Htranscription initiation factor TFIID 30 kD subunit, TAFII30TAF(II)30, TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD, Transcription initiation factor TFIID 30 kDa subunit, transcription initiation factor TFIID subunit 10

Gene Symbol

TAF10

Additional TAF10 Products

Product Documents for TAF10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF10 Antibody - BSA Free and earn rewards!

Have you used TAF10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...