TAF12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88403

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TAF12. Peptide sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TAF12 Antibody - BSA Free

Western Blot: TAF12 Antibody [NBP2-88403]

Western Blot: TAF12 Antibody [NBP2-88403]

Western Blot: TAF12 Antibody [NBP2-88403] - WB Suggested Anti-TAF12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293TTAF12 is supported by BioGPS gene expression data to be expressed in HEK293T
Chromatin Immunoprecipitation: TAF12 Antibody [NBP2-88403] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Applications for TAF12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF12

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene.

Alternate Names

20kDa, TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF15, TAF2J, TAFII-20/TAFII-15, TAFII20TAFII20/TAFII15, TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD, Transcription initiation factor TFIID 20/15 kDa subunits, transcription initiation factor TFIID subunit 12

Gene Symbol

TAF12

Additional TAF12 Products

Product Documents for TAF12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF12 Antibody - BSA Free and earn rewards!

Have you used TAF12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...