TAF1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82353

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B. Peptide sequence: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TAF1B Antibody - BSA Free

Western Blot: TAF1B Antibody [NBP2-82353]

Western Blot: TAF1B Antibody [NBP2-82353]

Western Blot: TAF1B Antibody [NBP2-82353] - WB Suggested Anti-TAF1B Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: SP2/0 cell lysate

Applications for TAF1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF1B

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes one of the SL1-specific TAFs. [provided by RefSeq]

Alternate Names

RAF1BTATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kD, RAFI63MGC:9349, RNA polymerase I-specific TBP-associated factor 63 kDa, SL1SL1, 63kD subunit, TAFI63TBP-associated factor 1B, TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa, TATA box-binding protein-associated factor 1B, TATA box-binding protein-associated factor RNA polymerase I subunit B, Transcription initiation factor SL1/TIF-IB subunit B

Gene Symbol

TAF1B

Additional TAF1B Products

Product Documents for TAF1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF1B Antibody - BSA Free and earn rewards!

Have you used TAF1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...