TAFA4/FAM19A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10582

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TAFA4/FAM19A4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat TAFA4/FAM19A4 (NP_001128172). Peptide sequence VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TAFA4/FAM19A4 Antibody - BSA Free

Western Blot: TAFA4/FAM19A4 Antibody [NBP3-10582]

Western Blot: TAFA4/FAM19A4 Antibody [NBP3-10582]

Western Blot: TAFA4/FAM19A4 Antibody [NBP3-10582] - Western blot analysis of TAFA4/FAM19A4 in Rat Kidney as a positive control. Antibody dilution at 1.0 ug/ml

Applications for TAFA4/FAM19A4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAFA4/FAM19A4

FAM19A4 is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene. [provided by RefSeq]

Long Name

Family with Sequence Similarity 19, Member A4

Alternate Names

FAM19A4

Gene Symbol

TAFA4

Additional TAFA4/FAM19A4 Products

Product Documents for TAFA4/FAM19A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAFA4/FAM19A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAFA4/FAM19A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAFA4/FAM19A4 Antibody - BSA Free and earn rewards!

Have you used TAFA4/FAM19A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies