TARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89427

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TARS Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TARS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TARS Antibody [NBP1-89427]

Immunocytochemistry/ Immunofluorescence: TARS Antibody [NBP1-89427]

Immunocytochemistry/Immunofluorescence: TARS Antibody [NBP1-89427] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427]

Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427]

Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Simple Western: TARS Antibody [NBP1-89427]

Simple Western: TARS Antibody [NBP1-89427]

Simple Western: TARS Antibody [NBP1-89427] - Electropherogram image of the corresponding Simple Western lane view. TARS antibody was used at 1:25 dilution on U-251 MG and H. Pancreas lysate(s) respectively.
TARS Antibody - BSA Free Western Blot: TARS Antibody - BSA Free [NBP1-89427]

Western Blot: TARS Antibody - BSA Free [NBP1-89427]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line U-251 MG

Applications for TARS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in U-251 MG and H. pancreas lysates, separated by Size, antibody dilution of 1:25

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TARS

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family

Alternate Names

cytoplasmic, EC 6.1.1.3, MGC9344, Threonine--tRNA ligase, threonyl-tRNA synthetase, threonyl-tRNA synthetase, cytoplasmic

Gene Symbol

TARS1

Additional TARS Products

Product Documents for TARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TARS Antibody - BSA Free and earn rewards!

Have you used TARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies