Testisin/Prss21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79539

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Testisin/Prss21 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Testisin/Prss21 Antibody - BSA Free

Western Blot: Testisin/Prss21 Antibody [NBP1-79539]

Western Blot: Testisin/Prss21 Antibody [NBP1-79539]

Western Blot: Testisin Antibody [NBP1-79539] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Testisin/Prss21 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Testisin/Prss21

Testisin encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms. [provided by RefSeq]

Alternate Names

Prss21, TEST1

Gene Symbol

PRSS21

UniProt

NP_659206 (Human)

Additional Testisin/Prss21 Products

Product Documents for Testisin/Prss21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Testisin/Prss21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Serine Proteases and Regulators

Customer Reviews for Testisin/Prss21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Testisin/Prss21 Antibody - BSA Free and earn rewards!

Have you used Testisin/Prss21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies